PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 812aa    MW: 91023 Da    PI: 5.1969
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018917.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.46.5e-1114358081373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL+ cA+avs++d++ +++lL++++++asp+gd  qRla++f+++L+ar+a++++++ k   +s  ++++ ++ l++++++  ++P  +++ l  
  Pbr018917.1 435 LRNLLILCAQAVSTNDFRTTSELLKQVRQHASPNGDGSQRLAHFFANGLEARMAGTGTGTQKFY-TSLVKRSSAVDMLKSYQVYISACPSKRMCMLFK 531
                  6899***************************************************999888755.5555557899*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++Il+ +e+++++Hi+Df+i +G+QWp L+q L++R++gpp+lRiTg++ p++g   +e +eetg+rL +++e+++vpfe+n+++++++e+++le+L
  Pbr018917.1 532 NKMILKMAEKATTLHIVDFGILYGFQWPILIQHLSKRRGGPPKLRITGIEVPQPGfrPAEWIEETGRRLGRYCERFNVPFEYNAIASQDWESIQLEDL 629
                  ******************************************************9*99**************************9999********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E+laVn++++ ++llde+v+++ +rd+vL+l+++++P+++v++  + ++n++ F++rf eal +ys+lfd+++ ++pr++eer   E e+ gr
  Pbr018917.1 630 KTERNEVLAVNCMFRFKNLLDETVEVNCPRDAVLQLIRRMKPDIFVHSIINGSYNAPFFVTRFREALFHYSSLFDAFDINIPRDNEERLRFESEFYGR 727
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  e++nv+aceg er+er et+++W+ r ++aG++p++l+++ +k  k  ++  + + + v+++ +++++gWk+r +++ S+W
  Pbr018917.1 728 EAMNVIACEGVERVERPETYKQWQVRCMRAGLQPLQLDQDLVKILKDKVKAWYHKDFVVDQDGDWMIQGWKGRIVYASSCW 808
                  *****************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.256409789IPR005202Transcription factor GRAS
PfamPF035142.3E-108435808IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MDHPTFNGSP DYMNGFSIDD LAFSPNSTQF SNLTNEYQFN QFSPDLNFMD NHFSLPPDFE  60
QGNIVPKVSL TTSGESSVPS NSLSPPDGGS LSLPTAVSVG GVDSSSDDND FSEAVFKYVN  120
QILLEENIEK KPGMFFDPLG LRVTEKSFYD VLGQQYPFSP NQQPLHINPN VESPDGNNSG  180
SCGDCSGSNN SPSPGTSNSI DPQRVGDSGD QKSSFPETTL PNDNPFQFTS HSSSQLSVPL  240
ENRMTSVGDG QHVGGGQRLD DMLQGSSVEE FVAQNIYTDS DSILQFQRGL EEASKFLPKS  300
TQLLVDLEIN TVSPEVKASV PMVTVQKEKS ERKNSPNGSK GRKNREWEDV DLEEGRSSKQ  360
SAVYIEKTEE SELSEMFDKV LLSTGGNNEF QCDNVAFKNE ASKTLQPSGQ PQGSNGNGRK  420
ARGKKQGKKK ETVDLRNLLI LCAQAVSTND FRTTSELLKQ VRQHASPNGD GSQRLAHFFA  480
NGLEARMAGT GTGTQKFYTS LVKRSSAVDM LKSYQVYISA CPSKRMCMLF KNKMILKMAE  540
KATTLHIVDF GILYGFQWPI LIQHLSKRRG GPPKLRITGI EVPQPGFRPA EWIEETGRRL  600
GRYCERFNVP FEYNAIASQD WESIQLEDLK TERNEVLAVN CMFRFKNLLD ETVEVNCPRD  660
AVLQLIRRMK PDIFVHSIIN GSYNAPFFVT RFREALFHYS SLFDAFDINI PRDNEERLRF  720
ESEFYGREAM NVIACEGVER VERPETYKQW QVRCMRAGLQ PLQLDQDLVK ILKDKVKAWY  780
HKDFVVDQDG DWMIQGWKGR IVYASSCWVP V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-434398088374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375903.10.0PREDICTED: scarecrow-like protein 34
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WK680.0M5WK68_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14